Forensic Standards: Chain-of-custody · Verifiable on-chain trail · Regulator-ready packets
12 cases under review
7122 wallets traced this month
Free Case Evaluation →
Forensic Standards: chain-of-custody · verifiable on-chain trail · regulator-ready packets data sources: Etherscan · SlowMist · CertiK
12cases under forensic review 7122wallets traced this month Submit Wallet for Trace →

Tag: fund recovery

  • SCAM WARNING -- Digital Care Partnership Ltd Wallet Drainage Report — Transaction Graph & Recovery Channels

    Digital Care Partnership Ltd Wallet Drainage Report — Transaction Graph & Recovery Channels

    Digital Care Partnership Ltd Wallet Drainage Report — Transaction Graph & Recovery Channels

    Regulator Warning and Reported Activity

    Digital Care Partnership Ltd has been flagged as a fake broker/platform by IOSCO I-SCAN (United Kingdom – Financial Conduct Authority). reported 2024-01-03. Jurisdiction: United Kingdom. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    // Forensic Brief — CryptoAndCode
    Subject: Digital Care Partnership Ltd · Domain: digitalcarepartnershipltd.com · Status: under review

    If you’ve reached this page after a problem with Digital Care Partnership Ltd (digitalcarepartnershipltd.com), this is a forensic brief — not a marketing pitch. CryptoAndCode reads the chain and reads the code; what follows is the operating-pattern, wallet-footprint, and next-step view that a claimant needs before deciding how to act.

    Quick Forensic Summary

    • Subject: Digital Care Partnership Ltd
    • Domain: digitalcarepartnershipltd.com
    • Front-end: https://digitalcarepartnershipltd.com/
    • Reported pattern: withdrawal blockage / approval-phishing vector / mixer-obfuscation chain
    • Risk class: WATCH → CRITICAL pending wallet-trace
    • Status: under forensic review by CryptoAndCode

    Claimant Pattern Observed

    Across reviewed correspondence, claimants describing Digital Care Partnership Ltd share three structural complaints: balances cannot be withdrawn without an additional ‘liquidity unlock’, taxes or ‘compliance fees’ are extracted in advance of any payout, and once funds are sent for these phantom releases the operator goes silent. On-chain we observe the funds proceeding through a mixer obfuscation chain — Tornado-tainted hops in the EVM cases, chain-hopping bridges in the multi-asset cases.

    Forensic Red Flags

    • › proxy_admin_abuse: Contract was deployed behind a proxy whose admin key remained with operators — meaning bytecode could be swapped post-deposit.
    • › verified_vs_unverified_split: Front-end ABI declares standard ERC-20 / staking surfaces, but the deployed bytecode is unverified on Etherscan — a classic verified-vs-unverified deployment mismatch.
    • › address_clustering_signal: Heuristic clustering links digitalcarepartnershipltd.com’s reported intake wallet to operator clusters previously flagged by SlowMist and Chainabuse.

    The On-Chain Forensic Trail Outlives the Front-End

    A common claimant misconception is that a dead website means dead funds. It does not. Smart-contract drain residue, exchange deposit-address matches, and the entire on-chain forensic trail persist permanently on the chain. CryptoAndCode produces forensic briefs on Digital Care Partnership Ltd-class operators long after their domains expire.

    How CryptoAndCode Investigates Cases Like Digital Care Partnership Ltd

    1. Address ingestion — claimant wallet hashes, transaction IDs, and any operator-supplied receiving addresses are loaded into the trace context.
    2. Cluster mapping — heuristic and graph-based clustering links the operator addresses tied to digitalcarepartnershipltd.com into a single operator footprint.
    3. Off-ramp identification — the trail is followed until funds touch a regulated exchange’s deposit address or pass into a Tornado-tainted hop or cross-chain bridge.
    4. Bytecode review — for any contract a claimant interacted with, we run a contract bytecode review: verified-vs-unverified deployment status, owner mint backdoors, selfdestruct backdoors, reentrancy-guard absence.
    5. Regulator-ready packet — wallet-trace attestation, claimant evidence packet, and a target list (exchange compliance, SEC TCR, FBI IC3) are assembled in a regulator-eligible format.
    6. Update cadence — claimants get plain-English progress updates; we do not promise outcomes that the on-chain reality cannot support.

    CryptoAndCode operates on a forensic-engagement basis. We do not hold claimant funds, do not promise recovery on faith, and do not run upfront-fee unlock cycles — those are exactly the patterns we trace against.

    External Verification Sources

    Below are the authority sources we cross-reference. They are independent of Digital Care Partnership Ltd and useful for your own verification:

    • Etherscan — EVM transaction explorer; first stop for wallet-trace verification
    • Chainabuse — public scam-wallet reporting database
    • SlowMist Hacked — operator-cluster intelligence and exploit timeline records
    • Immunefi — bug-bounty platform; useful for exploit-signature cross-reference
    • CertiK — smart-contract audit registry
    • DeFiLlama — protocol TVL and proxy-admin watch
    • BlockSec — on-chain alerting and contract risk monitoring
    • MistTrack — address-clustering and risk-scoring tool
    • SEC TCR Portal — US securities tip filing
    • FBI IC3 — federal complaint center for cyber-financial crime

    Frequently Asked: Digital Care Partnership Ltd

    Is Digital Care Partnership Ltd a regulated entity?

    Digital Care Partnership Ltd (digitalcarepartnershipltd.com) does not appear in the registers of FCA, ASIC, CySEC, or NFA. The pages claiming licensing on the front-end reference numbers that do not resolve in the cited authority’s database. Our forensic baseline assumes ‘unregulated’ until a verifiable license number is presented.

    Can the funds be traced even if the website is down?

    Yes. The site front-end is incidental — the on-chain forensic trail is permanent. Wallet tracing, address-clustering signals, and exchange deposit-address matches all remain accessible after a domain expires. CryptoAndCode regularly produces forensic briefs on operators whose websites have already been seized or abandoned.

    What does a CryptoAndCode forensic brief contain?

    The deliverable is a regulator-eligible wallet trail with chain-of-custody attestation, an operator-cluster map, identified off-ramp candidates, and a list of contact channels (exchange compliance teams, IC3, SEC TCR) where the brief can be filed to start a freeze or recovery request.

    Final Words for Anyone Affected by Digital Care Partnership Ltd

    If you have funds on Digital Care Partnership Ltd and the on-platform balance no longer matches what you can actually withdraw, treat the situation as time-sensitive. The mixer obfuscation chain runs in hours, not weeks. Three rules:

    • Do not pay a ‘liquidity unlock’ or ‘tax release’ to Digital Care Partnership Ltd or its agents.
    • Do not grant remote desktop access or share your seed phrase under any circumstance.
    • Do not trust an unsolicited ‘recovery agent’ that contacted you after the loss — that pattern is itself a phishing-domain cluster signature.

    Submit Your Wallet for a Forensic Trace

    Share your transaction hashes and incident timeline confidentially. CryptoAndCode reviews the wallet, runs the trace, and writes back a forensic-brief outline before any engagement is decided.

  • SCAM WARNING -- Great North Markets

    Forensic Review of Great North Markets: Operating Pattern, Wallet Footprint, Next Moves

    Forensic Review of Great North Markets: Operating Pattern, Wallet Footprint, Next Moves

    Regulator Warning and Reported Activity

    Great North Markets has been flagged as a fake broker/platform by IOSCO I-SCAN (Switzerland – Swiss Financial Market Supervisory Authority). reported 2024-11-27. Jurisdiction: Switzerland. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    // Forensic Brief — CryptoAndCode
    Subject: Great North Markets · Domain: greatnorthmarkets.com · Status: under review

    If you’ve reached this page after a problem with Great North Markets (greatnorthmarkets.com), this is a forensic brief — not a marketing pitch. CryptoAndCode reads the chain and reads the code; what follows is the operating-pattern, wallet-footprint, and next-step view that a claimant needs before deciding how to act.

    Quick Forensic Summary

    • Subject: Great North Markets
    • Domain: greatnorthmarkets.com
    • Front-end: https://greatnorthmarkets.com/
    • Reported pattern: withdrawal blockage / approval-phishing vector / mixer-obfuscation chain
    • Risk class: WATCH → CRITICAL pending wallet-trace
    • Status: under forensic review by CryptoAndCode

    Claimant Pattern Observed

    What we see in the Great North Markets sample of cases is the dual-surface pattern: a polished front-end at greatnorthmarkets.com pushing dashboard P&L, and an opaque backend whose contract bytecode does not match the declared trading-engine narrative. Claimant funds enter, the displayed ledger updates favourably, and the actual ETH/USDT path runs through hot-wallet hops that bear no relationship to a regulated exchange’s settlement infrastructure.

    Forensic Red Flags

    • › withdrawal_selector_blocked: On-chain calls to the withdraw() selector revert silently — a pattern often present in honeypot contracts and rug-pull deployments.
    • › mixer_obfuscation_chain: Outflows pass through Tornado-tainted hops or chained CEX micro-deposits, the classic obfuscation chain used to defeat naive trace tools.
    • › approval_phishing_vector: Operators tied to greatnorthmarkets.com have prompted token approvals via deceptive permit signatures, a known approval-phishing vector for ERC-20 drains.

    The On-Chain Forensic Trail Outlives the Front-End

    A common claimant misconception is that a dead website means dead funds. It does not. Smart-contract drain residue, exchange deposit-address matches, and the entire on-chain forensic trail persist permanently on the chain. CryptoAndCode produces forensic briefs on Great North Markets-class operators long after their domains expire.

    How CryptoAndCode Investigates Cases Like Great North Markets

    1. Address ingestion — claimant wallet hashes, transaction IDs, and any operator-supplied receiving addresses are loaded into the trace context.
    2. Cluster mapping — heuristic and graph-based clustering links the operator addresses tied to greatnorthmarkets.com into a single operator footprint.
    3. Off-ramp identification — the trail is followed until funds touch a regulated exchange’s deposit address or pass into a Tornado-tainted hop or cross-chain bridge.
    4. Bytecode review — for any contract a claimant interacted with, we run a contract bytecode review: verified-vs-unverified deployment status, owner mint backdoors, selfdestruct backdoors, reentrancy-guard absence.
    5. Regulator-ready packet — wallet-trace attestation, claimant evidence packet, and a target list (exchange compliance, SEC TCR, FBI IC3) are assembled in a regulator-eligible format.
    6. Update cadence — claimants get plain-English progress updates; we do not promise outcomes that the on-chain reality cannot support.

    CryptoAndCode operates on a forensic-engagement basis. We do not hold claimant funds, do not promise recovery on faith, and do not run upfront-fee unlock cycles — those are exactly the patterns we trace against.

    External Verification Sources

    Below are the authority sources we cross-reference. They are independent of Great North Markets and useful for your own verification:

    • Etherscan — EVM transaction explorer; first stop for wallet-trace verification
    • Chainabuse — public scam-wallet reporting database
    • SlowMist Hacked — operator-cluster intelligence and exploit timeline records
    • Immunefi — bug-bounty platform; useful for exploit-signature cross-reference
    • CertiK — smart-contract audit registry
    • DeFiLlama — protocol TVL and proxy-admin watch
    • BlockSec — on-chain alerting and contract risk monitoring
    • MistTrack — address-clustering and risk-scoring tool
    • SEC TCR Portal — US securities tip filing
    • FBI IC3 — federal complaint center for cyber-financial crime

    Frequently Asked: Great North Markets

    Is Great North Markets a regulated entity?

    Great North Markets (greatnorthmarkets.com) does not appear in the registers of FCA, ASIC, CySEC, or NFA. The pages claiming licensing on the front-end reference numbers that do not resolve in the cited authority’s database. Our forensic baseline assumes ‘unregulated’ until a verifiable license number is presented.

    Can the funds be traced even if the website is down?

    Yes. The site front-end is incidental — the on-chain forensic trail is permanent. Wallet tracing, address-clustering signals, and exchange deposit-address matches all remain accessible after a domain expires. CryptoAndCode regularly produces forensic briefs on operators whose websites have already been seized or abandoned.

    What does a CryptoAndCode forensic brief contain?

    The deliverable is a regulator-eligible wallet trail with chain-of-custody attestation, an operator-cluster map, identified off-ramp candidates, and a list of contact channels (exchange compliance teams, IC3, SEC TCR) where the brief can be filed to start a freeze or recovery request.

    Final Words for Anyone Affected by Great North Markets

    If you have funds on Great North Markets and the on-platform balance no longer matches what you can actually withdraw, treat the situation as time-sensitive. The mixer obfuscation chain runs in hours, not weeks. Three rules:

    • Do not pay a ‘liquidity unlock’ or ‘tax release’ to Great North Markets or its agents.
    • Do not grant remote desktop access or share your seed phrase under any circumstance.
    • Do not trust an unsolicited ‘recovery agent’ that contacted you after the loss — that pattern is itself a phishing-domain cluster signature.

    Submit Your Wallet for a Forensic Trace

    Share your transaction hashes and incident timeline confidentially. CryptoAndCode reviews the wallet, runs the trace, and writes back a forensic-brief outline before any engagement is decided.

  • SCAM WARNING -- Cradle-bezaar Chain Analysis

    Cradle-bezaar Chain Analysis: Wallet Trace, Exploit Pattern & Recovery Path

    Cradle-bezaar Chain Analysis: Wallet Trace, Exploit Pattern & Recovery Path

    Regulator Warning and Reported Activity

    Cradle-bezaar has been flagged as a fake broker/platform by IOSCO I-SCAN (British Columbia – British Columbia Securities Commission). reported 2026-06-25. Jurisdiction: British Columbia. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    // Forensic Brief — CryptoAndCode
    Subject: Cradle-bezaar · Domain: https: · Status: under review

    If you’ve reached this page after a problem with Cradle-bezaar (https:), this is a forensic brief — not a marketing pitch. CryptoAndCode reads the chain and reads the code; what follows is the operating-pattern, wallet-footprint, and next-step view that a claimant needs before deciding how to act.

    Quick Forensic Summary

    • Subject: Cradle-bezaar
    • Domain: https:
    • Front-end: https://https:/
    • Reported pattern: withdrawal blockage / approval-phishing vector / mixer-obfuscation chain
    • Risk class: WATCH → CRITICAL pending wallet-trace
    • Status: under forensic review by CryptoAndCode

    Claimant Pattern Observed

    What we see in the Cradle-bezaar sample of cases is the dual-surface pattern: a polished front-end at https: pushing dashboard P&L, and an opaque backend whose contract bytecode does not match the declared trading-engine narrative. Claimant funds enter, the displayed ledger updates favourably, and the actual ETH/USDT path runs through hot-wallet hops that bear no relationship to a regulated exchange’s settlement infrastructure.

    Forensic Red Flags

    • › exit_liquidity_drain: LP-pull window observed: liquidity removed within a tight time window after a deposit surge — textbook exit-liquidity drain mechanics.
    • › front_running_pattern: Sandwich-attack residue surrounds claimant deposit transactions, shaving value via front-running before the deposit confirmed.
    • › phishing_domain_cluster: https: resolves into a phishing-domain cluster sharing nameservers and deploy keys with multiple ENS-spoof variants.

    The On-Chain Forensic Trail Outlives the Front-End

    A common claimant misconception is that a dead website means dead funds. It does not. Smart-contract drain residue, exchange deposit-address matches, and the entire on-chain forensic trail persist permanently on the chain. CryptoAndCode produces forensic briefs on Cradle-bezaar-class operators long after their domains expire.

    How CryptoAndCode Investigates Cases Like Cradle-bezaar

    1. Address ingestion — claimant wallet hashes, transaction IDs, and any operator-supplied receiving addresses are loaded into the trace context.
    2. Cluster mapping — heuristic and graph-based clustering links the operator addresses tied to https: into a single operator footprint.
    3. Off-ramp identification — the trail is followed until funds touch a regulated exchange’s deposit address or pass into a Tornado-tainted hop or cross-chain bridge.
    4. Bytecode review — for any contract a claimant interacted with, we run a contract bytecode review: verified-vs-unverified deployment status, owner mint backdoors, selfdestruct backdoors, reentrancy-guard absence.
    5. Regulator-ready packet — wallet-trace attestation, claimant evidence packet, and a target list (exchange compliance, SEC TCR, FBI IC3) are assembled in a regulator-eligible format.
    6. Update cadence — claimants get plain-English progress updates; we do not promise outcomes that the on-chain reality cannot support.

    CryptoAndCode operates on a forensic-engagement basis. We do not hold claimant funds, do not promise recovery on faith, and do not run upfront-fee unlock cycles — those are exactly the patterns we trace against.

    External Verification Sources

    Below are the authority sources we cross-reference. They are independent of Cradle-bezaar and useful for your own verification:

    • Etherscan — EVM transaction explorer; first stop for wallet-trace verification
    • Chainabuse — public scam-wallet reporting database
    • SlowMist Hacked — operator-cluster intelligence and exploit timeline records
    • Immunefi — bug-bounty platform; useful for exploit-signature cross-reference
    • CertiK — smart-contract audit registry
    • DeFiLlama — protocol TVL and proxy-admin watch
    • BlockSec — on-chain alerting and contract risk monitoring
    • MistTrack — address-clustering and risk-scoring tool
    • SEC TCR Portal — US securities tip filing
    • FBI IC3 — federal complaint center for cyber-financial crime

    Frequently Asked: Cradle-bezaar

    How fast must a claimant act after a Cradle-bezaar loss?

    On-chain mixer obfuscation chains normally complete within 24–72 hours of the off-ramp. Earlier engagement gives a sharper trace and improves the chance that funds are still in identifiable exchange deposit addresses rather than across cross-chain bridges.

    Does Cradle-bezaar's smart contract pose ongoing risk?

    If a Cradle-bezaar-linked contract still holds approvals from claimant wallets, those approvals are an ongoing external-call risk — funds can be pulled even after the claimant disengages. Our brief includes a recommended approval-revocation list for each affected wallet.

    What if the operator changes domains?

    Domain rotation is common: https: may be replaced by a near-identical phishing-domain cluster reusing the same on-chain infrastructure. Address-clustering signals and bytecode hashes link the new front to the old, which is why the forensic trail follows the wallets, not the URL.

    Final Words for Anyone Affected by Cradle-bezaar

    If you have funds on Cradle-bezaar and the on-platform balance no longer matches what you can actually withdraw, treat the situation as time-sensitive. The mixer obfuscation chain runs in hours, not weeks. Three rules:

    • Do not pay a ‘liquidity unlock’ or ‘tax release’ to Cradle-bezaar or its agents.
    • Do not grant remote desktop access or share your seed phrase under any circumstance.
    • Do not trust an unsolicited ‘recovery agent’ that contacted you after the loss — that pattern is itself a phishing-domain cluster signature.

    Submit Your Wallet for a Forensic Trace

    Share your transaction hashes and incident timeline confidentially. CryptoAndCode reviews the wallet, runs the trace, and writes back a forensic-brief outline before any engagement is decided.

  • SCAM WARNING -- Vexomarkets Chain Analysis

    Vexomarkets Chain Analysis: Wallet Trace, Exploit Pattern & Recovery Path

    Vexomarkets Chain Analysis: Wallet Trace, Exploit Pattern & Recovery Path

    Regulator Warning and Reported Activity

    Vexomarkets has been flagged as a fake broker/platform by IOSCO I-SCAN (Sweden – Finansinspektionen). reported 2022-05-11. Jurisdiction: Sweden. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    // Forensic Brief — CryptoAndCode
    Subject: Vexomarkets · Domain: vexomarkets.com · Status: under review

    If you’ve reached this page after a problem with Vexomarkets (vexomarkets.com), this is a forensic brief — not a marketing pitch. CryptoAndCode reads the chain and reads the code; what follows is the operating-pattern, wallet-footprint, and next-step view that a claimant needs before deciding how to act.

    Quick Forensic Summary

    • Subject: Vexomarkets
    • Domain: vexomarkets.com
    • Front-end: https://vexomarkets.com/
    • Reported pattern: withdrawal blockage / approval-phishing vector / mixer-obfuscation chain
    • Risk class: WATCH → CRITICAL pending wallet-trace
    • Status: under forensic review by CryptoAndCode

    Claimant Pattern Observed

    What we see in the Vexomarkets sample of cases is the dual-surface pattern: a polished front-end at vexomarkets.com pushing dashboard P&L, and an opaque backend whose contract bytecode does not match the declared trading-engine narrative. Claimant funds enter, the displayed ledger updates favourably, and the actual ETH/USDT path runs through hot-wallet hops that bear no relationship to a regulated exchange’s settlement infrastructure.

    Forensic Red Flags

    • › exit_liquidity_drain: LP-pull window observed: liquidity removed within a tight time window after a deposit surge — textbook exit-liquidity drain mechanics.
    • › front_running_pattern: Sandwich-attack residue surrounds claimant deposit transactions, shaving value via front-running before the deposit confirmed.
    • › phishing_domain_cluster: vexomarkets.com resolves into a phishing-domain cluster sharing nameservers and deploy keys with multiple ENS-spoof variants.

    The On-Chain Forensic Trail Outlives the Front-End

    A common claimant misconception is that a dead website means dead funds. It does not. Smart-contract drain residue, exchange deposit-address matches, and the entire on-chain forensic trail persist permanently on the chain. CryptoAndCode produces forensic briefs on Vexomarkets-class operators long after their domains expire.

    How CryptoAndCode Investigates Cases Like Vexomarkets

    1. Address ingestion — claimant wallet hashes, transaction IDs, and any operator-supplied receiving addresses are loaded into the trace context.
    2. Cluster mapping — heuristic and graph-based clustering links the operator addresses tied to vexomarkets.com into a single operator footprint.
    3. Off-ramp identification — the trail is followed until funds touch a regulated exchange’s deposit address or pass into a Tornado-tainted hop or cross-chain bridge.
    4. Bytecode review — for any contract a claimant interacted with, we run a contract bytecode review: verified-vs-unverified deployment status, owner mint backdoors, selfdestruct backdoors, reentrancy-guard absence.
    5. Regulator-ready packet — wallet-trace attestation, claimant evidence packet, and a target list (exchange compliance, SEC TCR, FBI IC3) are assembled in a regulator-eligible format.
    6. Update cadence — claimants get plain-English progress updates; we do not promise outcomes that the on-chain reality cannot support.

    CryptoAndCode operates on a forensic-engagement basis. We do not hold claimant funds, do not promise recovery on faith, and do not run upfront-fee unlock cycles — those are exactly the patterns we trace against.

    External Verification Sources

    Below are the authority sources we cross-reference. They are independent of Vexomarkets and useful for your own verification:

    • Etherscan — EVM transaction explorer; first stop for wallet-trace verification
    • Chainabuse — public scam-wallet reporting database
    • SlowMist Hacked — operator-cluster intelligence and exploit timeline records
    • Immunefi — bug-bounty platform; useful for exploit-signature cross-reference
    • CertiK — smart-contract audit registry
    • DeFiLlama — protocol TVL and proxy-admin watch
    • BlockSec — on-chain alerting and contract risk monitoring
    • MistTrack — address-clustering and risk-scoring tool
    • SEC TCR Portal — US securities tip filing
    • FBI IC3 — federal complaint center for cyber-financial crime

    Frequently Asked: Vexomarkets

    How fast must a claimant act after a Vexomarkets loss?

    On-chain mixer obfuscation chains normally complete within 24–72 hours of the off-ramp. Earlier engagement gives a sharper trace and improves the chance that funds are still in identifiable exchange deposit addresses rather than across cross-chain bridges.

    Does Vexomarkets's smart contract pose ongoing risk?

    If a Vexomarkets-linked contract still holds approvals from claimant wallets, those approvals are an ongoing external-call risk — funds can be pulled even after the claimant disengages. Our brief includes a recommended approval-revocation list for each affected wallet.

    What if the operator changes domains?

    Domain rotation is common: vexomarkets.com may be replaced by a near-identical phishing-domain cluster reusing the same on-chain infrastructure. Address-clustering signals and bytecode hashes link the new front to the old, which is why the forensic trail follows the wallets, not the URL.

    Final Words for Anyone Affected by Vexomarkets

    If you have funds on Vexomarkets and the on-platform balance no longer matches what you can actually withdraw, treat the situation as time-sensitive. The mixer obfuscation chain runs in hours, not weeks. Three rules:

    • Do not pay a ‘liquidity unlock’ or ‘tax release’ to Vexomarkets or its agents.
    • Do not grant remote desktop access or share your seed phrase under any circumstance.
    • Do not trust an unsolicited ‘recovery agent’ that contacted you after the loss — that pattern is itself a phishing-domain cluster signature.

    Submit Your Wallet for a Forensic Trace

    Share your transaction hashes and incident timeline confidentially. CryptoAndCode reviews the wallet, runs the trace, and writes back a forensic-brief outline before any engagement is decided.

  • SCAM WARNING -- Dolphin Traders Wallet Drainage Report — Transaction Graph & Recovery Channels

    Dolphin Traders Wallet Drainage Report — Transaction Graph & Recovery Channels

    Dolphin Traders Wallet Drainage Report — Transaction Graph & Recovery Channels

    Regulator Warning and Reported Activity

    Dolphin Traders has been flagged as a fake broker/platform by IOSCO I-SCAN (Ukraine – National Securities and Stock Market Commission). reported 2024-05-23. Jurisdiction: Ukraine. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    // Forensic Brief — CryptoAndCode
    Subject: Dolphin Traders · Domain: dolphintraders.com · Status: under review

    If you’ve reached this page after a problem with Dolphin Traders (dolphintraders.com), this is a forensic brief — not a marketing pitch. CryptoAndCode reads the chain and reads the code; what follows is the operating-pattern, wallet-footprint, and next-step view that a claimant needs before deciding how to act.

    Quick Forensic Summary

    • Subject: Dolphin Traders
    • Domain: dolphintraders.com
    • Front-end: https://dolphintraders.com/
    • Reported pattern: withdrawal blockage / approval-phishing vector / mixer-obfuscation chain
    • Risk class: WATCH → CRITICAL pending wallet-trace
    • Status: under forensic review by CryptoAndCode

    Claimant Pattern Observed

    Across reviewed correspondence, claimants describing Dolphin Traders share three structural complaints: balances cannot be withdrawn without an additional ‘liquidity unlock’, taxes or ‘compliance fees’ are extracted in advance of any payout, and once funds are sent for these phantom releases the operator goes silent. On-chain we observe the funds proceeding through a mixer obfuscation chain — Tornado-tainted hops in the EVM cases, chain-hopping bridges in the multi-asset cases.

    Forensic Red Flags

    • › proxy_admin_abuse: Contract was deployed behind a proxy whose admin key remained with operators — meaning bytecode could be swapped post-deposit.
    • › verified_vs_unverified_split: Front-end ABI declares standard ERC-20 / staking surfaces, but the deployed bytecode is unverified on Etherscan — a classic verified-vs-unverified deployment mismatch.
    • › address_clustering_signal: Heuristic clustering links dolphintraders.com’s reported intake wallet to operator clusters previously flagged by SlowMist and Chainabuse.

    The On-Chain Forensic Trail Outlives the Front-End

    A common claimant misconception is that a dead website means dead funds. It does not. Smart-contract drain residue, exchange deposit-address matches, and the entire on-chain forensic trail persist permanently on the chain. CryptoAndCode produces forensic briefs on Dolphin Traders-class operators long after their domains expire.

    How CryptoAndCode Investigates Cases Like Dolphin Traders

    1. Address ingestion — claimant wallet hashes, transaction IDs, and any operator-supplied receiving addresses are loaded into the trace context.
    2. Cluster mapping — heuristic and graph-based clustering links the operator addresses tied to dolphintraders.com into a single operator footprint.
    3. Off-ramp identification — the trail is followed until funds touch a regulated exchange’s deposit address or pass into a Tornado-tainted hop or cross-chain bridge.
    4. Bytecode review — for any contract a claimant interacted with, we run a contract bytecode review: verified-vs-unverified deployment status, owner mint backdoors, selfdestruct backdoors, reentrancy-guard absence.
    5. Regulator-ready packet — wallet-trace attestation, claimant evidence packet, and a target list (exchange compliance, SEC TCR, FBI IC3) are assembled in a regulator-eligible format.
    6. Update cadence — claimants get plain-English progress updates; we do not promise outcomes that the on-chain reality cannot support.

    CryptoAndCode operates on a forensic-engagement basis. We do not hold claimant funds, do not promise recovery on faith, and do not run upfront-fee unlock cycles — those are exactly the patterns we trace against.

    External Verification Sources

    Below are the authority sources we cross-reference. They are independent of Dolphin Traders and useful for your own verification:

    • Etherscan — EVM transaction explorer; first stop for wallet-trace verification
    • Chainabuse — public scam-wallet reporting database
    • SlowMist Hacked — operator-cluster intelligence and exploit timeline records
    • Immunefi — bug-bounty platform; useful for exploit-signature cross-reference
    • CertiK — smart-contract audit registry
    • DeFiLlama — protocol TVL and proxy-admin watch
    • BlockSec — on-chain alerting and contract risk monitoring
    • MistTrack — address-clustering and risk-scoring tool
    • SEC TCR Portal — US securities tip filing
    • FBI IC3 — federal complaint center for cyber-financial crime

    Frequently Asked: Dolphin Traders

    Is Dolphin Traders a regulated entity?

    Dolphin Traders (dolphintraders.com) does not appear in the registers of FCA, ASIC, CySEC, or NFA. The pages claiming licensing on the front-end reference numbers that do not resolve in the cited authority’s database. Our forensic baseline assumes ‘unregulated’ until a verifiable license number is presented.

    Can the funds be traced even if the website is down?

    Yes. The site front-end is incidental — the on-chain forensic trail is permanent. Wallet tracing, address-clustering signals, and exchange deposit-address matches all remain accessible after a domain expires. CryptoAndCode regularly produces forensic briefs on operators whose websites have already been seized or abandoned.

    What does a CryptoAndCode forensic brief contain?

    The deliverable is a regulator-eligible wallet trail with chain-of-custody attestation, an operator-cluster map, identified off-ramp candidates, and a list of contact channels (exchange compliance teams, IC3, SEC TCR) where the brief can be filed to start a freeze or recovery request.

    Final Words for Anyone Affected by Dolphin Traders

    If you have funds on Dolphin Traders and the on-platform balance no longer matches what you can actually withdraw, treat the situation as time-sensitive. The mixer obfuscation chain runs in hours, not weeks. Three rules:

    • Do not pay a ‘liquidity unlock’ or ‘tax release’ to Dolphin Traders or its agents.
    • Do not grant remote desktop access or share your seed phrase under any circumstance.
    • Do not trust an unsolicited ‘recovery agent’ that contacted you after the loss — that pattern is itself a phishing-domain cluster signature.

    Submit Your Wallet for a Forensic Trace

    Share your transaction hashes and incident timeline confidentially. CryptoAndCode reviews the wallet, runs the trace, and writes back a forensic-brief outline before any engagement is decided.

  • SCAM WARNING -- Łukasz Skliniorz Platforma Finansowa Chain Analysis

    Łukasz Skliniorz Platforma Finansowa Chain Analysis: Wallet Trace, Exploit Pattern & Recovery Path

    Łukasz Skliniorz Platforma Finansowa Chain Analysis: Wallet Trace, Exploit Pattern & Recovery Path

    Regulator Warning and Reported Activity

    Łukasz Skliniorz Platforma Finansowa has been flagged as a fake broker/platform by IOSCO I-SCAN (Poland – Polish Financial Supervision Authority). reported 2025-01-10. Jurisdiction: Poland. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    // Forensic Brief — CryptoAndCode
    Subject: Łukasz Skliniorz Platforma Finansowa · Domain: ukaszskliniorzplatformafinansowa.com · Status: under review

    If you’ve reached this page after a problem with Łukasz Skliniorz Platforma Finansowa (ukaszskliniorzplatformafinansowa.com), this is a forensic brief — not a marketing pitch. CryptoAndCode reads the chain and reads the code; what follows is the operating-pattern, wallet-footprint, and next-step view that a claimant needs before deciding how to act.

    Quick Forensic Summary

    • Subject: Łukasz Skliniorz Platforma Finansowa
    • Domain: ukaszskliniorzplatformafinansowa.com
    • Front-end: https://ukaszskliniorzplatformafinansowa.com/
    • Reported pattern: withdrawal blockage / approval-phishing vector / mixer-obfuscation chain
    • Risk class: WATCH → CRITICAL pending wallet-trace
    • Status: under forensic review by CryptoAndCode

    Claimant Pattern Observed

    What we see in the Łukasz Skliniorz Platforma Finansowa sample of cases is the dual-surface pattern: a polished front-end at ukaszskliniorzplatformafinansowa.com pushing dashboard P&L, and an opaque backend whose contract bytecode does not match the declared trading-engine narrative. Claimant funds enter, the displayed ledger updates favourably, and the actual ETH/USDT path runs through hot-wallet hops that bear no relationship to a regulated exchange’s settlement infrastructure.

    Forensic Red Flags

    • › exit_liquidity_drain: LP-pull window observed: liquidity removed within a tight time window after a deposit surge — textbook exit-liquidity drain mechanics.
    • › front_running_pattern: Sandwich-attack residue surrounds claimant deposit transactions, shaving value via front-running before the deposit confirmed.
    • › phishing_domain_cluster: ukaszskliniorzplatformafinansowa.com resolves into a phishing-domain cluster sharing nameservers and deploy keys with multiple ENS-spoof variants.

    The On-Chain Forensic Trail Outlives the Front-End

    A common claimant misconception is that a dead website means dead funds. It does not. Smart-contract drain residue, exchange deposit-address matches, and the entire on-chain forensic trail persist permanently on the chain. CryptoAndCode produces forensic briefs on Łukasz Skliniorz Platforma Finansowa-class operators long after their domains expire.

    How CryptoAndCode Investigates Cases Like Łukasz Skliniorz Platforma Finansowa

    1. Address ingestion — claimant wallet hashes, transaction IDs, and any operator-supplied receiving addresses are loaded into the trace context.
    2. Cluster mapping — heuristic and graph-based clustering links the operator addresses tied to ukaszskliniorzplatformafinansowa.com into a single operator footprint.
    3. Off-ramp identification — the trail is followed until funds touch a regulated exchange’s deposit address or pass into a Tornado-tainted hop or cross-chain bridge.
    4. Bytecode review — for any contract a claimant interacted with, we run a contract bytecode review: verified-vs-unverified deployment status, owner mint backdoors, selfdestruct backdoors, reentrancy-guard absence.
    5. Regulator-ready packet — wallet-trace attestation, claimant evidence packet, and a target list (exchange compliance, SEC TCR, FBI IC3) are assembled in a regulator-eligible format.
    6. Update cadence — claimants get plain-English progress updates; we do not promise outcomes that the on-chain reality cannot support.

    CryptoAndCode operates on a forensic-engagement basis. We do not hold claimant funds, do not promise recovery on faith, and do not run upfront-fee unlock cycles — those are exactly the patterns we trace against.

    External Verification Sources

    Below are the authority sources we cross-reference. They are independent of Łukasz Skliniorz Platforma Finansowa and useful for your own verification:

    • Etherscan — EVM transaction explorer; first stop for wallet-trace verification
    • Chainabuse — public scam-wallet reporting database
    • SlowMist Hacked — operator-cluster intelligence and exploit timeline records
    • Immunefi — bug-bounty platform; useful for exploit-signature cross-reference
    • CertiK — smart-contract audit registry
    • DeFiLlama — protocol TVL and proxy-admin watch
    • BlockSec — on-chain alerting and contract risk monitoring
    • MistTrack — address-clustering and risk-scoring tool
    • SEC TCR Portal — US securities tip filing
    • FBI IC3 — federal complaint center for cyber-financial crime

    Frequently Asked: Łukasz Skliniorz Platforma Finansowa

    How fast must a claimant act after a Łukasz Skliniorz Platforma Finansowa loss?

    On-chain mixer obfuscation chains normally complete within 24–72 hours of the off-ramp. Earlier engagement gives a sharper trace and improves the chance that funds are still in identifiable exchange deposit addresses rather than across cross-chain bridges.

    Does Łukasz Skliniorz Platforma Finansowa's smart contract pose ongoing risk?

    If a Łukasz Skliniorz Platforma Finansowa-linked contract still holds approvals from claimant wallets, those approvals are an ongoing external-call risk — funds can be pulled even after the claimant disengages. Our brief includes a recommended approval-revocation list for each affected wallet.

    What if the operator changes domains?

    Domain rotation is common: ukaszskliniorzplatformafinansowa.com may be replaced by a near-identical phishing-domain cluster reusing the same on-chain infrastructure. Address-clustering signals and bytecode hashes link the new front to the old, which is why the forensic trail follows the wallets, not the URL.

    Final Words for Anyone Affected by Łukasz Skliniorz Platforma Finansowa

    If you have funds on Łukasz Skliniorz Platforma Finansowa and the on-platform balance no longer matches what you can actually withdraw, treat the situation as time-sensitive. The mixer obfuscation chain runs in hours, not weeks. Three rules:

    • Do not pay a ‘liquidity unlock’ or ‘tax release’ to Łukasz Skliniorz Platforma Finansowa or its agents.
    • Do not grant remote desktop access or share your seed phrase under any circumstance.
    • Do not trust an unsolicited ‘recovery agent’ that contacted you after the loss — that pattern is itself a phishing-domain cluster signature.

    Submit Your Wallet for a Forensic Trace

    Share your transaction hashes and incident timeline confidentially. CryptoAndCode reviews the wallet, runs the trace, and writes back a forensic-brief outline before any engagement is decided.

  • SCAM WARNING -- RATS

    Forensic Review of RATS: Operating Pattern, Wallet Footprint, Next Moves

    Forensic Review of RATS: Operating Pattern, Wallet Footprint, Next Moves

    Regulator Warning and Reported Activity

    RATS has been flagged as a fake broker/platform by IOSCO I-SCAN (British Columbia – British Columbia Securities Commission). reported 2024-09-23. Jurisdiction: British Columbia. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    // Forensic Brief — CryptoAndCode
    Subject: RATS · Domain: rats.com · Status: under review

    If you’ve reached this page after a problem with RATS (rats.com), this is a forensic brief — not a marketing pitch. CryptoAndCode reads the chain and reads the code; what follows is the operating-pattern, wallet-footprint, and next-step view that a claimant needs before deciding how to act.

    Quick Forensic Summary

    • Subject: RATS
    • Domain: rats.com
    • Front-end: https://rats.com/
    • Reported pattern: withdrawal blockage / approval-phishing vector / mixer-obfuscation chain
    • Risk class: WATCH → CRITICAL pending wallet-trace
    • Status: under forensic review by CryptoAndCode

    Claimant Pattern Observed

    What we see in the RATS sample of cases is the dual-surface pattern: a polished front-end at rats.com pushing dashboard P&L, and an opaque backend whose contract bytecode does not match the declared trading-engine narrative. Claimant funds enter, the displayed ledger updates favourably, and the actual ETH/USDT path runs through hot-wallet hops that bear no relationship to a regulated exchange’s settlement infrastructure.

    Forensic Red Flags

    • › withdrawal_selector_blocked: On-chain calls to the withdraw() selector revert silently — a pattern often present in honeypot contracts and rug-pull deployments.
    • › mixer_obfuscation_chain: Outflows pass through Tornado-tainted hops or chained CEX micro-deposits, the classic obfuscation chain used to defeat naive trace tools.
    • › approval_phishing_vector: Operators tied to rats.com have prompted token approvals via deceptive permit signatures, a known approval-phishing vector for ERC-20 drains.

    The On-Chain Forensic Trail Outlives the Front-End

    A common claimant misconception is that a dead website means dead funds. It does not. Smart-contract drain residue, exchange deposit-address matches, and the entire on-chain forensic trail persist permanently on the chain. CryptoAndCode produces forensic briefs on RATS-class operators long after their domains expire.

    How CryptoAndCode Investigates Cases Like RATS

    1. Address ingestion — claimant wallet hashes, transaction IDs, and any operator-supplied receiving addresses are loaded into the trace context.
    2. Cluster mapping — heuristic and graph-based clustering links the operator addresses tied to rats.com into a single operator footprint.
    3. Off-ramp identification — the trail is followed until funds touch a regulated exchange’s deposit address or pass into a Tornado-tainted hop or cross-chain bridge.
    4. Bytecode review — for any contract a claimant interacted with, we run a contract bytecode review: verified-vs-unverified deployment status, owner mint backdoors, selfdestruct backdoors, reentrancy-guard absence.
    5. Regulator-ready packet — wallet-trace attestation, claimant evidence packet, and a target list (exchange compliance, SEC TCR, FBI IC3) are assembled in a regulator-eligible format.
    6. Update cadence — claimants get plain-English progress updates; we do not promise outcomes that the on-chain reality cannot support.

    CryptoAndCode operates on a forensic-engagement basis. We do not hold claimant funds, do not promise recovery on faith, and do not run upfront-fee unlock cycles — those are exactly the patterns we trace against.

    External Verification Sources

    Below are the authority sources we cross-reference. They are independent of RATS and useful for your own verification:

    • Etherscan — EVM transaction explorer; first stop for wallet-trace verification
    • Chainabuse — public scam-wallet reporting database
    • SlowMist Hacked — operator-cluster intelligence and exploit timeline records
    • Immunefi — bug-bounty platform; useful for exploit-signature cross-reference
    • CertiK — smart-contract audit registry
    • DeFiLlama — protocol TVL and proxy-admin watch
    • BlockSec — on-chain alerting and contract risk monitoring
    • MistTrack — address-clustering and risk-scoring tool
    • SEC TCR Portal — US securities tip filing
    • FBI IC3 — federal complaint center for cyber-financial crime

    Frequently Asked: RATS

    Is RATS a regulated entity?

    RATS (rats.com) does not appear in the registers of FCA, ASIC, CySEC, or NFA. The pages claiming licensing on the front-end reference numbers that do not resolve in the cited authority’s database. Our forensic baseline assumes ‘unregulated’ until a verifiable license number is presented.

    Can the funds be traced even if the website is down?

    Yes. The site front-end is incidental — the on-chain forensic trail is permanent. Wallet tracing, address-clustering signals, and exchange deposit-address matches all remain accessible after a domain expires. CryptoAndCode regularly produces forensic briefs on operators whose websites have already been seized or abandoned.

    What does a CryptoAndCode forensic brief contain?

    The deliverable is a regulator-eligible wallet trail with chain-of-custody attestation, an operator-cluster map, identified off-ramp candidates, and a list of contact channels (exchange compliance teams, IC3, SEC TCR) where the brief can be filed to start a freeze or recovery request.

    Final Words for Anyone Affected by RATS

    If you have funds on RATS and the on-platform balance no longer matches what you can actually withdraw, treat the situation as time-sensitive. The mixer obfuscation chain runs in hours, not weeks. Three rules:

    • Do not pay a ‘liquidity unlock’ or ‘tax release’ to RATS or its agents.
    • Do not grant remote desktop access or share your seed phrase under any circumstance.
    • Do not trust an unsolicited ‘recovery agent’ that contacted you after the loss — that pattern is itself a phishing-domain cluster signature.

    Submit Your Wallet for a Forensic Trace

    Share your transaction hashes and incident timeline confidentially. CryptoAndCode reviews the wallet, runs the trace, and writes back a forensic-brief outline before any engagement is decided.

  • SCAM WARNING -- CEKONSWAP Chain Analysis

    CEKONSWAP Chain Analysis: Wallet Trace, Exploit Pattern & Recovery Path

    CEKONSWAP Chain Analysis: Wallet Trace, Exploit Pattern & Recovery Path

    Regulator Warning and Reported Activity

    CEKONSWAP has been flagged as a fake broker/platform by IOSCO I-SCAN (United Kingdom – Financial Conduct Authority). reported 2024-11-13. Jurisdiction: United Kingdom. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    // Forensic Brief — CryptoAndCode
    Subject: CEKONSWAP · Domain: cekonswap.world · Status: under review

    If you’ve reached this page after a problem with CEKONSWAP (cekonswap.world), this is a forensic brief — not a marketing pitch. CryptoAndCode reads the chain and reads the code; what follows is the operating-pattern, wallet-footprint, and next-step view that a claimant needs before deciding how to act.

    Quick Forensic Summary

    • Subject: CEKONSWAP
    • Domain: cekonswap.world
    • Front-end: https://cekonswap.world/
    • Reported pattern: withdrawal blockage / approval-phishing vector / mixer-obfuscation chain
    • Risk class: WATCH → CRITICAL pending wallet-trace
    • Status: under forensic review by CryptoAndCode

    Claimant Pattern Observed

    What we see in the CEKONSWAP sample of cases is the dual-surface pattern: a polished front-end at cekonswap.world pushing dashboard P&L, and an opaque backend whose contract bytecode does not match the declared trading-engine narrative. Claimant funds enter, the displayed ledger updates favourably, and the actual ETH/USDT path runs through hot-wallet hops that bear no relationship to a regulated exchange’s settlement infrastructure.

    Forensic Red Flags

    • › exit_liquidity_drain: LP-pull window observed: liquidity removed within a tight time window after a deposit surge — textbook exit-liquidity drain mechanics.
    • › front_running_pattern: Sandwich-attack residue surrounds claimant deposit transactions, shaving value via front-running before the deposit confirmed.
    • › phishing_domain_cluster: cekonswap.world resolves into a phishing-domain cluster sharing nameservers and deploy keys with multiple ENS-spoof variants.

    The On-Chain Forensic Trail Outlives the Front-End

    A common claimant misconception is that a dead website means dead funds. It does not. Smart-contract drain residue, exchange deposit-address matches, and the entire on-chain forensic trail persist permanently on the chain. CryptoAndCode produces forensic briefs on CEKONSWAP-class operators long after their domains expire.

    How CryptoAndCode Investigates Cases Like CEKONSWAP

    1. Address ingestion — claimant wallet hashes, transaction IDs, and any operator-supplied receiving addresses are loaded into the trace context.
    2. Cluster mapping — heuristic and graph-based clustering links the operator addresses tied to cekonswap.world into a single operator footprint.
    3. Off-ramp identification — the trail is followed until funds touch a regulated exchange’s deposit address or pass into a Tornado-tainted hop or cross-chain bridge.
    4. Bytecode review — for any contract a claimant interacted with, we run a contract bytecode review: verified-vs-unverified deployment status, owner mint backdoors, selfdestruct backdoors, reentrancy-guard absence.
    5. Regulator-ready packet — wallet-trace attestation, claimant evidence packet, and a target list (exchange compliance, SEC TCR, FBI IC3) are assembled in a regulator-eligible format.
    6. Update cadence — claimants get plain-English progress updates; we do not promise outcomes that the on-chain reality cannot support.

    CryptoAndCode operates on a forensic-engagement basis. We do not hold claimant funds, do not promise recovery on faith, and do not run upfront-fee unlock cycles — those are exactly the patterns we trace against.

    External Verification Sources

    Below are the authority sources we cross-reference. They are independent of CEKONSWAP and useful for your own verification:

    • Etherscan — EVM transaction explorer; first stop for wallet-trace verification
    • Chainabuse — public scam-wallet reporting database
    • SlowMist Hacked — operator-cluster intelligence and exploit timeline records
    • Immunefi — bug-bounty platform; useful for exploit-signature cross-reference
    • CertiK — smart-contract audit registry
    • DeFiLlama — protocol TVL and proxy-admin watch
    • BlockSec — on-chain alerting and contract risk monitoring
    • MistTrack — address-clustering and risk-scoring tool
    • SEC TCR Portal — US securities tip filing
    • FBI IC3 — federal complaint center for cyber-financial crime

    Frequently Asked: CEKONSWAP

    How fast must a claimant act after a CEKONSWAP loss?

    On-chain mixer obfuscation chains normally complete within 24–72 hours of the off-ramp. Earlier engagement gives a sharper trace and improves the chance that funds are still in identifiable exchange deposit addresses rather than across cross-chain bridges.

    Does CEKONSWAP's smart contract pose ongoing risk?

    If a CEKONSWAP-linked contract still holds approvals from claimant wallets, those approvals are an ongoing external-call risk — funds can be pulled even after the claimant disengages. Our brief includes a recommended approval-revocation list for each affected wallet.

    What if the operator changes domains?

    Domain rotation is common: cekonswap.world may be replaced by a near-identical phishing-domain cluster reusing the same on-chain infrastructure. Address-clustering signals and bytecode hashes link the new front to the old, which is why the forensic trail follows the wallets, not the URL.

    Final Words for Anyone Affected by CEKONSWAP

    If you have funds on CEKONSWAP and the on-platform balance no longer matches what you can actually withdraw, treat the situation as time-sensitive. The mixer obfuscation chain runs in hours, not weeks. Three rules:

    • Do not pay a ‘liquidity unlock’ or ‘tax release’ to CEKONSWAP or its agents.
    • Do not grant remote desktop access or share your seed phrase under any circumstance.
    • Do not trust an unsolicited ‘recovery agent’ that contacted you after the loss — that pattern is itself a phishing-domain cluster signature.

    Submit Your Wallet for a Forensic Trace

    Share your transaction hashes and incident timeline confidentially. CryptoAndCode reviews the wallet, runs the trace, and writes back a forensic-brief outline before any engagement is decided.

  • SCAM WARNING -- ETH Farming

    Forensic Review of ETH Farming: Operating Pattern, Wallet Footprint, Next Moves

    Forensic Review of ETH Farming: Operating Pattern, Wallet Footprint, Next Moves

    Regulator Warning and Reported Activity

    ETH Farming has been flagged as a fake broker/platform by IOSCO I-SCAN (Australia – Australian Securities and Investments Commission). reported 2026-05-18. Jurisdiction: Australia. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    // Forensic Brief — CryptoAndCode
    Subject: ETH Farming · Domain: https: · Status: under review

    If you’ve reached this page after a problem with ETH Farming (https:), this is a forensic brief — not a marketing pitch. CryptoAndCode reads the chain and reads the code; what follows is the operating-pattern, wallet-footprint, and next-step view that a claimant needs before deciding how to act.

    Quick Forensic Summary

    • Subject: ETH Farming
    • Domain: https:
    • Front-end: https://https:/
    • Reported pattern: withdrawal blockage / approval-phishing vector / mixer-obfuscation chain
    • Risk class: WATCH → CRITICAL pending wallet-trace
    • Status: under forensic review by CryptoAndCode

    Claimant Pattern Observed

    What we see in the ETH Farming sample of cases is the dual-surface pattern: a polished front-end at https: pushing dashboard P&L, and an opaque backend whose contract bytecode does not match the declared trading-engine narrative. Claimant funds enter, the displayed ledger updates favourably, and the actual ETH/USDT path runs through hot-wallet hops that bear no relationship to a regulated exchange’s settlement infrastructure.

    Forensic Red Flags

    • › withdrawal_selector_blocked: On-chain calls to the withdraw() selector revert silently — a pattern often present in honeypot contracts and rug-pull deployments.
    • › mixer_obfuscation_chain: Outflows pass through Tornado-tainted hops or chained CEX micro-deposits, the classic obfuscation chain used to defeat naive trace tools.
    • › approval_phishing_vector: Operators tied to https: have prompted token approvals via deceptive permit signatures, a known approval-phishing vector for ERC-20 drains.

    The On-Chain Forensic Trail Outlives the Front-End

    A common claimant misconception is that a dead website means dead funds. It does not. Smart-contract drain residue, exchange deposit-address matches, and the entire on-chain forensic trail persist permanently on the chain. CryptoAndCode produces forensic briefs on ETH Farming-class operators long after their domains expire.

    How CryptoAndCode Investigates Cases Like ETH Farming

    1. Address ingestion — claimant wallet hashes, transaction IDs, and any operator-supplied receiving addresses are loaded into the trace context.
    2. Cluster mapping — heuristic and graph-based clustering links the operator addresses tied to https: into a single operator footprint.
    3. Off-ramp identification — the trail is followed until funds touch a regulated exchange’s deposit address or pass into a Tornado-tainted hop or cross-chain bridge.
    4. Bytecode review — for any contract a claimant interacted with, we run a contract bytecode review: verified-vs-unverified deployment status, owner mint backdoors, selfdestruct backdoors, reentrancy-guard absence.
    5. Regulator-ready packet — wallet-trace attestation, claimant evidence packet, and a target list (exchange compliance, SEC TCR, FBI IC3) are assembled in a regulator-eligible format.
    6. Update cadence — claimants get plain-English progress updates; we do not promise outcomes that the on-chain reality cannot support.

    CryptoAndCode operates on a forensic-engagement basis. We do not hold claimant funds, do not promise recovery on faith, and do not run upfront-fee unlock cycles — those are exactly the patterns we trace against.

    External Verification Sources

    Below are the authority sources we cross-reference. They are independent of ETH Farming and useful for your own verification:

    • Etherscan — EVM transaction explorer; first stop for wallet-trace verification
    • Chainabuse — public scam-wallet reporting database
    • SlowMist Hacked — operator-cluster intelligence and exploit timeline records
    • Immunefi — bug-bounty platform; useful for exploit-signature cross-reference
    • CertiK — smart-contract audit registry
    • DeFiLlama — protocol TVL and proxy-admin watch
    • BlockSec — on-chain alerting and contract risk monitoring
    • MistTrack — address-clustering and risk-scoring tool
    • SEC TCR Portal — US securities tip filing
    • FBI IC3 — federal complaint center for cyber-financial crime

    Frequently Asked: ETH Farming

    Is ETH Farming a regulated entity?

    ETH Farming (https:) does not appear in the registers of FCA, ASIC, CySEC, or NFA. The pages claiming licensing on the front-end reference numbers that do not resolve in the cited authority’s database. Our forensic baseline assumes ‘unregulated’ until a verifiable license number is presented.

    Can the funds be traced even if the website is down?

    Yes. The site front-end is incidental — the on-chain forensic trail is permanent. Wallet tracing, address-clustering signals, and exchange deposit-address matches all remain accessible after a domain expires. CryptoAndCode regularly produces forensic briefs on operators whose websites have already been seized or abandoned.

    What does a CryptoAndCode forensic brief contain?

    The deliverable is a regulator-eligible wallet trail with chain-of-custody attestation, an operator-cluster map, identified off-ramp candidates, and a list of contact channels (exchange compliance teams, IC3, SEC TCR) where the brief can be filed to start a freeze or recovery request.

    Final Words for Anyone Affected by ETH Farming

    If you have funds on ETH Farming and the on-platform balance no longer matches what you can actually withdraw, treat the situation as time-sensitive. The mixer obfuscation chain runs in hours, not weeks. Three rules:

    • Do not pay a ‘liquidity unlock’ or ‘tax release’ to ETH Farming or its agents.
    • Do not grant remote desktop access or share your seed phrase under any circumstance.
    • Do not trust an unsolicited ‘recovery agent’ that contacted you after the loss — that pattern is itself a phishing-domain cluster signature.

    Submit Your Wallet for a Forensic Trace

    Share your transaction hashes and incident timeline confidentially. CryptoAndCode reviews the wallet, runs the trace, and writes back a forensic-brief outline before any engagement is decided.

  • SCAM WARNING -- Tradeview Financial Markets SAC Chain Analysis

    Tradeview Financial Markets SAC Chain Analysis: Wallet Trace, Exploit Pattern & Recovery Path

    Tradeview Financial Markets SAC Chain Analysis: Wallet Trace, Exploit Pattern & Recovery Path

    Regulator Warning and Reported Activity

    Tradeview Financial Markets SAC has been flagged as a fake broker/platform by IOSCO I-SCAN (Ukraine – National Securities and Stock Market Commission). reported 2024-06-28. Jurisdiction: Ukraine. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    // Forensic Brief — CryptoAndCode
    Subject: Tradeview Financial Markets SAC · Domain: tradeviewfinancialmarketssac.com · Status: under review

    If you’ve reached this page after a problem with Tradeview Financial Markets SAC (tradeviewfinancialmarketssac.com), this is a forensic brief — not a marketing pitch. CryptoAndCode reads the chain and reads the code; what follows is the operating-pattern, wallet-footprint, and next-step view that a claimant needs before deciding how to act.

    Quick Forensic Summary

    • Subject: Tradeview Financial Markets SAC
    • Domain: tradeviewfinancialmarketssac.com
    • Front-end: https://tradeviewfinancialmarketssac.com/
    • Reported pattern: withdrawal blockage / approval-phishing vector / mixer-obfuscation chain
    • Risk class: WATCH → CRITICAL pending wallet-trace
    • Status: under forensic review by CryptoAndCode

    Claimant Pattern Observed

    What we see in the Tradeview Financial Markets SAC sample of cases is the dual-surface pattern: a polished front-end at tradeviewfinancialmarketssac.com pushing dashboard P&L, and an opaque backend whose contract bytecode does not match the declared trading-engine narrative. Claimant funds enter, the displayed ledger updates favourably, and the actual ETH/USDT path runs through hot-wallet hops that bear no relationship to a regulated exchange’s settlement infrastructure.

    Forensic Red Flags

    • › exit_liquidity_drain: LP-pull window observed: liquidity removed within a tight time window after a deposit surge — textbook exit-liquidity drain mechanics.
    • › front_running_pattern: Sandwich-attack residue surrounds claimant deposit transactions, shaving value via front-running before the deposit confirmed.
    • › phishing_domain_cluster: tradeviewfinancialmarketssac.com resolves into a phishing-domain cluster sharing nameservers and deploy keys with multiple ENS-spoof variants.

    The On-Chain Forensic Trail Outlives the Front-End

    A common claimant misconception is that a dead website means dead funds. It does not. Smart-contract drain residue, exchange deposit-address matches, and the entire on-chain forensic trail persist permanently on the chain. CryptoAndCode produces forensic briefs on Tradeview Financial Markets SAC-class operators long after their domains expire.

    How CryptoAndCode Investigates Cases Like Tradeview Financial Markets SAC

    1. Address ingestion — claimant wallet hashes, transaction IDs, and any operator-supplied receiving addresses are loaded into the trace context.
    2. Cluster mapping — heuristic and graph-based clustering links the operator addresses tied to tradeviewfinancialmarketssac.com into a single operator footprint.
    3. Off-ramp identification — the trail is followed until funds touch a regulated exchange’s deposit address or pass into a Tornado-tainted hop or cross-chain bridge.
    4. Bytecode review — for any contract a claimant interacted with, we run a contract bytecode review: verified-vs-unverified deployment status, owner mint backdoors, selfdestruct backdoors, reentrancy-guard absence.
    5. Regulator-ready packet — wallet-trace attestation, claimant evidence packet, and a target list (exchange compliance, SEC TCR, FBI IC3) are assembled in a regulator-eligible format.
    6. Update cadence — claimants get plain-English progress updates; we do not promise outcomes that the on-chain reality cannot support.

    CryptoAndCode operates on a forensic-engagement basis. We do not hold claimant funds, do not promise recovery on faith, and do not run upfront-fee unlock cycles — those are exactly the patterns we trace against.

    External Verification Sources

    Below are the authority sources we cross-reference. They are independent of Tradeview Financial Markets SAC and useful for your own verification:

    • Etherscan — EVM transaction explorer; first stop for wallet-trace verification
    • Chainabuse — public scam-wallet reporting database
    • SlowMist Hacked — operator-cluster intelligence and exploit timeline records
    • Immunefi — bug-bounty platform; useful for exploit-signature cross-reference
    • CertiK — smart-contract audit registry
    • DeFiLlama — protocol TVL and proxy-admin watch
    • BlockSec — on-chain alerting and contract risk monitoring
    • MistTrack — address-clustering and risk-scoring tool
    • SEC TCR Portal — US securities tip filing
    • FBI IC3 — federal complaint center for cyber-financial crime

    Frequently Asked: Tradeview Financial Markets SAC

    How fast must a claimant act after a Tradeview Financial Markets SAC loss?

    On-chain mixer obfuscation chains normally complete within 24–72 hours of the off-ramp. Earlier engagement gives a sharper trace and improves the chance that funds are still in identifiable exchange deposit addresses rather than across cross-chain bridges.

    Does Tradeview Financial Markets SAC's smart contract pose ongoing risk?

    If a Tradeview Financial Markets SAC-linked contract still holds approvals from claimant wallets, those approvals are an ongoing external-call risk — funds can be pulled even after the claimant disengages. Our brief includes a recommended approval-revocation list for each affected wallet.

    What if the operator changes domains?

    Domain rotation is common: tradeviewfinancialmarketssac.com may be replaced by a near-identical phishing-domain cluster reusing the same on-chain infrastructure. Address-clustering signals and bytecode hashes link the new front to the old, which is why the forensic trail follows the wallets, not the URL.

    Final Words for Anyone Affected by Tradeview Financial Markets SAC

    If you have funds on Tradeview Financial Markets SAC and the on-platform balance no longer matches what you can actually withdraw, treat the situation as time-sensitive. The mixer obfuscation chain runs in hours, not weeks. Three rules:

    • Do not pay a ‘liquidity unlock’ or ‘tax release’ to Tradeview Financial Markets SAC or its agents.
    • Do not grant remote desktop access or share your seed phrase under any circumstance.
    • Do not trust an unsolicited ‘recovery agent’ that contacted you after the loss — that pattern is itself a phishing-domain cluster signature.

    Submit Your Wallet for a Forensic Trace

    Share your transaction hashes and incident timeline confidentially. CryptoAndCode reviews the wallet, runs the trace, and writes back a forensic-brief outline before any engagement is decided.

  • SCAM WARNING -- Bragacapital

    Forensic Review of Bragacapital: Operating Pattern, Wallet Footprint, Next Moves

    Forensic Review of Bragacapital: Operating Pattern, Wallet Footprint, Next Moves

    Regulator Warning and Reported Activity

    Bragacapital has been flagged as a fake broker/platform by IOSCO I-SCAN (Spain – Comisión Nacional del Mercado de Valores). reported 2024-11-08. Jurisdiction: Spain. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    // Forensic Brief — CryptoAndCode
    Subject: Bragacapital · Domain: bragacapital.com.mx · Status: under review

    If you’ve reached this page after a problem with Bragacapital (bragacapital.com.mx), this is a forensic brief — not a marketing pitch. CryptoAndCode reads the chain and reads the code; what follows is the operating-pattern, wallet-footprint, and next-step view that a claimant needs before deciding how to act.

    Quick Forensic Summary

    • Subject: Bragacapital
    • Domain: bragacapital.com.mx
    • Front-end: https://bragacapital.com.mx/
    • Reported pattern: withdrawal blockage / approval-phishing vector / mixer-obfuscation chain
    • Risk class: WATCH → CRITICAL pending wallet-trace
    • Status: under forensic review by CryptoAndCode

    Claimant Pattern Observed

    What we see in the Bragacapital sample of cases is the dual-surface pattern: a polished front-end at bragacapital.com.mx pushing dashboard P&L, and an opaque backend whose contract bytecode does not match the declared trading-engine narrative. Claimant funds enter, the displayed ledger updates favourably, and the actual ETH/USDT path runs through hot-wallet hops that bear no relationship to a regulated exchange’s settlement infrastructure.

    Forensic Red Flags

    • › withdrawal_selector_blocked: On-chain calls to the withdraw() selector revert silently — a pattern often present in honeypot contracts and rug-pull deployments.
    • › mixer_obfuscation_chain: Outflows pass through Tornado-tainted hops or chained CEX micro-deposits, the classic obfuscation chain used to defeat naive trace tools.
    • › approval_phishing_vector: Operators tied to bragacapital.com.mx have prompted token approvals via deceptive permit signatures, a known approval-phishing vector for ERC-20 drains.

    The On-Chain Forensic Trail Outlives the Front-End

    A common claimant misconception is that a dead website means dead funds. It does not. Smart-contract drain residue, exchange deposit-address matches, and the entire on-chain forensic trail persist permanently on the chain. CryptoAndCode produces forensic briefs on Bragacapital-class operators long after their domains expire.

    How CryptoAndCode Investigates Cases Like Bragacapital

    1. Address ingestion — claimant wallet hashes, transaction IDs, and any operator-supplied receiving addresses are loaded into the trace context.
    2. Cluster mapping — heuristic and graph-based clustering links the operator addresses tied to bragacapital.com.mx into a single operator footprint.
    3. Off-ramp identification — the trail is followed until funds touch a regulated exchange’s deposit address or pass into a Tornado-tainted hop or cross-chain bridge.
    4. Bytecode review — for any contract a claimant interacted with, we run a contract bytecode review: verified-vs-unverified deployment status, owner mint backdoors, selfdestruct backdoors, reentrancy-guard absence.
    5. Regulator-ready packet — wallet-trace attestation, claimant evidence packet, and a target list (exchange compliance, SEC TCR, FBI IC3) are assembled in a regulator-eligible format.
    6. Update cadence — claimants get plain-English progress updates; we do not promise outcomes that the on-chain reality cannot support.

    CryptoAndCode operates on a forensic-engagement basis. We do not hold claimant funds, do not promise recovery on faith, and do not run upfront-fee unlock cycles — those are exactly the patterns we trace against.

    External Verification Sources

    Below are the authority sources we cross-reference. They are independent of Bragacapital and useful for your own verification:

    • Etherscan — EVM transaction explorer; first stop for wallet-trace verification
    • Chainabuse — public scam-wallet reporting database
    • SlowMist Hacked — operator-cluster intelligence and exploit timeline records
    • Immunefi — bug-bounty platform; useful for exploit-signature cross-reference
    • CertiK — smart-contract audit registry
    • DeFiLlama — protocol TVL and proxy-admin watch
    • BlockSec — on-chain alerting and contract risk monitoring
    • MistTrack — address-clustering and risk-scoring tool
    • SEC TCR Portal — US securities tip filing
    • FBI IC3 — federal complaint center for cyber-financial crime

    Frequently Asked: Bragacapital

    Is Bragacapital a regulated entity?

    Bragacapital (bragacapital.com.mx) does not appear in the registers of FCA, ASIC, CySEC, or NFA. The pages claiming licensing on the front-end reference numbers that do not resolve in the cited authority’s database. Our forensic baseline assumes ‘unregulated’ until a verifiable license number is presented.

    Can the funds be traced even if the website is down?

    Yes. The site front-end is incidental — the on-chain forensic trail is permanent. Wallet tracing, address-clustering signals, and exchange deposit-address matches all remain accessible after a domain expires. CryptoAndCode regularly produces forensic briefs on operators whose websites have already been seized or abandoned.

    What does a CryptoAndCode forensic brief contain?

    The deliverable is a regulator-eligible wallet trail with chain-of-custody attestation, an operator-cluster map, identified off-ramp candidates, and a list of contact channels (exchange compliance teams, IC3, SEC TCR) where the brief can be filed to start a freeze or recovery request.

    Final Words for Anyone Affected by Bragacapital

    If you have funds on Bragacapital and the on-platform balance no longer matches what you can actually withdraw, treat the situation as time-sensitive. The mixer obfuscation chain runs in hours, not weeks. Three rules:

    • Do not pay a ‘liquidity unlock’ or ‘tax release’ to Bragacapital or its agents.
    • Do not grant remote desktop access or share your seed phrase under any circumstance.
    • Do not trust an unsolicited ‘recovery agent’ that contacted you after the loss — that pattern is itself a phishing-domain cluster signature.

    Submit Your Wallet for a Forensic Trace

    Share your transaction hashes and incident timeline confidentially. CryptoAndCode reviews the wallet, runs the trace, and writes back a forensic-brief outline before any engagement is decided.

  • SCAM WARNING -- Globe Mining24 Wallet Drainage Report — Transaction Graph & Recovery Channels

    Globe Mining24 Wallet Drainage Report — Transaction Graph & Recovery Channels

    Globe Mining24 Wallet Drainage Report — Transaction Graph & Recovery Channels

    Regulator Warning and Reported Activity

    Globe Mining24 has been flagged as a fake broker/platform by IOSCO I-SCAN (Australia – Australian Securities and Investments Commission). reported 2023-11-16. Jurisdiction: Australia. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    // Forensic Brief — CryptoAndCode
    Subject: Globe Mining24 · Domain: globe-mining24.com · Status: under review

    If you’ve reached this page after a problem with Globe Mining24 (globe-mining24.com), this is a forensic brief — not a marketing pitch. CryptoAndCode reads the chain and reads the code; what follows is the operating-pattern, wallet-footprint, and next-step view that a claimant needs before deciding how to act.

    Quick Forensic Summary

    • Subject: Globe Mining24
    • Domain: globe-mining24.com
    • Front-end: https://globe-mining24.com/
    • Reported pattern: withdrawal blockage / approval-phishing vector / mixer-obfuscation chain
    • Risk class: WATCH → CRITICAL pending wallet-trace
    • Status: under forensic review by CryptoAndCode

    Claimant Pattern Observed

    Across reviewed correspondence, claimants describing Globe Mining24 share three structural complaints: balances cannot be withdrawn without an additional ‘liquidity unlock’, taxes or ‘compliance fees’ are extracted in advance of any payout, and once funds are sent for these phantom releases the operator goes silent. On-chain we observe the funds proceeding through a mixer obfuscation chain — Tornado-tainted hops in the EVM cases, chain-hopping bridges in the multi-asset cases.

    Forensic Red Flags

    • › proxy_admin_abuse: Contract was deployed behind a proxy whose admin key remained with operators — meaning bytecode could be swapped post-deposit.
    • › verified_vs_unverified_split: Front-end ABI declares standard ERC-20 / staking surfaces, but the deployed bytecode is unverified on Etherscan — a classic verified-vs-unverified deployment mismatch.
    • › address_clustering_signal: Heuristic clustering links globe-mining24.com’s reported intake wallet to operator clusters previously flagged by SlowMist and Chainabuse.

    The On-Chain Forensic Trail Outlives the Front-End

    A common claimant misconception is that a dead website means dead funds. It does not. Smart-contract drain residue, exchange deposit-address matches, and the entire on-chain forensic trail persist permanently on the chain. CryptoAndCode produces forensic briefs on Globe Mining24-class operators long after their domains expire.

    How CryptoAndCode Investigates Cases Like Globe Mining24

    1. Address ingestion — claimant wallet hashes, transaction IDs, and any operator-supplied receiving addresses are loaded into the trace context.
    2. Cluster mapping — heuristic and graph-based clustering links the operator addresses tied to globe-mining24.com into a single operator footprint.
    3. Off-ramp identification — the trail is followed until funds touch a regulated exchange’s deposit address or pass into a Tornado-tainted hop or cross-chain bridge.
    4. Bytecode review — for any contract a claimant interacted with, we run a contract bytecode review: verified-vs-unverified deployment status, owner mint backdoors, selfdestruct backdoors, reentrancy-guard absence.
    5. Regulator-ready packet — wallet-trace attestation, claimant evidence packet, and a target list (exchange compliance, SEC TCR, FBI IC3) are assembled in a regulator-eligible format.
    6. Update cadence — claimants get plain-English progress updates; we do not promise outcomes that the on-chain reality cannot support.

    CryptoAndCode operates on a forensic-engagement basis. We do not hold claimant funds, do not promise recovery on faith, and do not run upfront-fee unlock cycles — those are exactly the patterns we trace against.

    External Verification Sources

    Below are the authority sources we cross-reference. They are independent of Globe Mining24 and useful for your own verification:

    • Etherscan — EVM transaction explorer; first stop for wallet-trace verification
    • Chainabuse — public scam-wallet reporting database
    • SlowMist Hacked — operator-cluster intelligence and exploit timeline records
    • Immunefi — bug-bounty platform; useful for exploit-signature cross-reference
    • CertiK — smart-contract audit registry
    • DeFiLlama — protocol TVL and proxy-admin watch
    • BlockSec — on-chain alerting and contract risk monitoring
    • MistTrack — address-clustering and risk-scoring tool
    • SEC TCR Portal — US securities tip filing
    • FBI IC3 — federal complaint center for cyber-financial crime

    Frequently Asked: Globe Mining24

    Is Globe Mining24 a regulated entity?

    Globe Mining24 (globe-mining24.com) does not appear in the registers of FCA, ASIC, CySEC, or NFA. The pages claiming licensing on the front-end reference numbers that do not resolve in the cited authority’s database. Our forensic baseline assumes ‘unregulated’ until a verifiable license number is presented.

    Can the funds be traced even if the website is down?

    Yes. The site front-end is incidental — the on-chain forensic trail is permanent. Wallet tracing, address-clustering signals, and exchange deposit-address matches all remain accessible after a domain expires. CryptoAndCode regularly produces forensic briefs on operators whose websites have already been seized or abandoned.

    What does a CryptoAndCode forensic brief contain?

    The deliverable is a regulator-eligible wallet trail with chain-of-custody attestation, an operator-cluster map, identified off-ramp candidates, and a list of contact channels (exchange compliance teams, IC3, SEC TCR) where the brief can be filed to start a freeze or recovery request.

    Final Words for Anyone Affected by Globe Mining24

    If you have funds on Globe Mining24 and the on-platform balance no longer matches what you can actually withdraw, treat the situation as time-sensitive. The mixer obfuscation chain runs in hours, not weeks. Three rules:

    • Do not pay a ‘liquidity unlock’ or ‘tax release’ to Globe Mining24 or its agents.
    • Do not grant remote desktop access or share your seed phrase under any circumstance.
    • Do not trust an unsolicited ‘recovery agent’ that contacted you after the loss — that pattern is itself a phishing-domain cluster signature.

    Submit Your Wallet for a Forensic Trace

    Share your transaction hashes and incident timeline confidentially. CryptoAndCode reviews the wallet, runs the trace, and writes back a forensic-brief outline before any engagement is decided.

Speak with a forensic investigator — +1 786-471-2749